ELF9`44 (44=o@\\/usr/lib/ld.so.1gd  !"#&'()*,-./23467:;>@DEFHIJLOPQRSTUVXYZ[\]_adfhklnpqsuvwxy|}    $&')*+-.0123579;<=@ACFHJOQRSTXZ\^_`b $%+01589<=?ABCGKMNW^`bcegijmortz{~  !"#%(,/468:>?BDEGIKLMNPUVWY[]acH d@ (/h4; CD LH aބ, ov|g@   `h  4    4 h (  X,  , 5 2T:BL L [t d 0iXx !8  0X $L 5|` $  hT =Xp   '4-P4L @\p R elP z  <  0H 0 P  L l&: ?< X<^eH sH|@    t  P"\  \p  #g\ + 18>Dp  LsP U @[0i]  t  |P   `  &  Xt $  #0 ,@3@9%  IXPHY`$t jq }Lm$t \PT Dp`5H  X   @ $X<  \, 75T( D QThH f  u` '|$ t'l x$ s   lt("L < x %  2 E O` V$< e mP s(  8P  @  TX       (   (t $ B@ Lp W9p d  t` W( \ X$ ]  4  `@  L, 4 ApL t ϰ   & + 6? @Y|l I00 [  ixP wx ~uh      |     , T  p  <  #Dd !#( /@T A<@ N@\ YP a( ld \d { _ 0 5    L`     9`   & <$H K R g88  m r=X |   | ,  d    0 $ ,  (L"7 S bh we  %\ m(  04 Tx , " /P T @sPX NT W^@ t |   D0   | !(hH 3ΰB  N V` `uH in @!strrchrlstatsleep_between_retrievalsstrchrrandconnect_to_onegetproxyfile_non_directory_pencode_stringmemsetfputsutimecookies_cleanupurl_set_filerecursive_cleanuprenameftp_sizeftp_retrmkalldirsftp_typeregister_htmlftp_process_type.mulres_parseuri_mergenetrc_listhtml_quote_string___Argvmemmoveurl_errorhash_table_putftp_rest_endvalid_progress_implementation_pread_file_freeprintf__xargcaddress_list_copy_oneinet_addrstring_hashopenwtimer_elapsedstring_set_containsstrcasecmpmemcpytest_socket_openftp_pasvchmodsscanflookup_host_sch_toupper_sch_tolowerredirect_outputxstrdup_lowerdetermine_screen_widthgen_md5_context_size.divsepstringheader_existsbindabortslist_nreversewtimer_newskip_lwsread_whole_lineenvironsufmatchhash_table_get__urem64ftp_listftp_loginheader_geturl_filenameiwriteopterrireadasctimetextdomainno_proxy_match_etextrbuf_flush_finiprogress_createmkdirdatetime_strstrcmpbindportftp_indexftp_responseoptopttime_strres_parse_from_fileMD5InitMD5Updategetsocknamecleanup_html_urldownloaded_increaseres_register_specsperrormap_html_tagsprogress_updatesave_log_pconnect_to_manystrlenforkftp_get_listingreadurl_schemestrdupaddress_list_match_allglobal_download_countcalculate_skey_responsestrptimeset_connection_host_nameprogress_handle_sigwinch_exitoptargget_urls_html_environscheme_disablerbuf_uninitializegetpwuidfrontcmprbuf_read_bufferfulfprintf__cg92_usedmerge_vecs__flsbufurl_parseinitializehash_table_countftp_last_resplinefnmatch.uremgetenvfopencloselogputslogflush__iobgethostbynameparse_lineprogress_finishhash_table_get_pairmktimehash_table_mapaccept_domainstrcpysetlocaleheader_strdupurl_has_schemelegiblebuild_cookies_requestscheme_default_portaccdirftp_portfflushioctlstring_set_freeunlink__assertstrtokretr_ratestrtolgetopt_longstataccepthas_wildcards_p_DYNAMICsrandmatch_tailstrncasecmpoptfilenowtimer_deleteftp_systpath_simplifyrewindurl_freeslist_freesleepreallocfcloseaddress_list_set_faultywtimer_resetftp_parse_lsset_cookie_header_cbres_match_pathres_retrieve_fileselectlegible_very_longtimenumdigitgetuidhash_table_clear.umullogprintfmake_directorygettextstrpbrk__udiv64free_vec__builtin_allocaget_contentsrbuf_discardfork_to_backgroundvsnprintfgmtimestring_set_addftp_cwdtouchlong_to_string_lib_versionres_cleanupinet_ntoaconvert_linkslistenhash_table_destroyhash_table_containsaccess_edataftruncatepretty_print_addressgetopthash_table_new__1cG__CrunMdo_exit_code6F_v_closeportfile_merge_sch_istabledownloaded_fileget_urls_filehttp_cleanupacceptablerbuf_initializeload_cookiesurl_full_pathwriteurl_skip_unameconnectxmalloc_realgettimeofdayconaddrdebug_logprintfcalc_rateh_errnoatoisetsockoptselect_fdhome_dirconvert_all_linksfile_exists_pxrealloc_realsocketlog_closefstatmake_string_hash_tableurl_set_dirsymlinkrotate_backupsstrcatgen_md5_updatexstrdup_realfwritestrncpyreadlinkprintwhatmemchrslist_appendslist_prependregister_downloadhost_cleanupacceptportherrmsgstring_cmpdownloaded_exceeds_quotafree_urlposmainsetvalunique_namewtimer_granularityretrieve_url_PROCEDURE_LINKAGE_TABLE_munmaphttp_atotmexec_namesprintfurl_skip_scheme_startftp_pwdheader_extract_numberslist_containsmallocregister_redirection_initfreehttp_loopres_get_specsoptindfree_netrclocaltimestrncmprewrite_shorthand_urlsuffixhash_table_remove_GLOBAL_OFFSET_TABLE_retrieve_from_fileatexitstrdupdelimerrno_get_exit_frame_monitorset_progress_implementationgen_md5_finishfgetcheader_process__fsr_init_valuesave_cookiesaddress_list_get_boundsfree_keys_and_valuescleanupmake_nocase_string_hash_tableexitwtimer_allocateaddress_list_release.remurl_stringsearch_netrc_getopt_internallog_set_flushftp_loopisattydownloaded_files_freeretrieve_treefgetsvfprintfgen_md5_initMD5Finalusleepbindtextdomainstrerrorstrstrsignalqsort__environ_lockread_fileprogress_schedule_redirectrbuf_initialized_pmemcmpcount_charversion_stringremove_link__xargvrbuf_peeklog_initmmap_ioblibmd5.so.1SUNW_1.1libsocket.so.1SISCD_2.3libnsl.so.1SUNW_0.7libc.so.1SUNW_1.1SUNWprivate_1.1libmd5.so.1libsocket.so.1libnsl.so.1libc.so.1s =' zt =( =' Nq\  (5 $30A<tHT-`Vlx<S _k' h,,8MDP1\=h,t-V [} (40@LXdp |T9 $'0<HT`lqxz$NJcRNU]^ P,D89DQP\ht$mi TM)bE(4@L6 @B"aآDB"a("bT, @'(H $H+`-` `?-)("L- =--% # @؆@؃ D("X ("\@w@z@P,@p@q㿠6Ԁ" 6 6!Ԁ`  6!!ԁϐp@\ F 6bϒb@U H 6㿐.` 737@L # @.%!6!Ԁ`!@B@?"Ȓ !Ԗ@N  @4 @M  @. B` @% @#? @   @?  B@c@MҐ Bက ϐ@N #Bc(2 $c(@c(ϔc$@M $c(㿐.`0@-@- }6 @-, ?? @Ԕ 6  @ x*"@ 'x '| @Ŗ " 㿘!6 '%(!ئ?$`$!ؐ  @נ $` ?` @ש B a`a 5%  a%%% % 5`!@z 6@x`"$``@Myc4$` " `@MoD  `'!@o6@X` "$``@MY`$` 6 `@^ @D``"$``@MEcp$`  㾘 @: 6   ( $@.  $ ''    @㿘!(B"` aH'є 4"` 6@&  Baϐc@L  㿠?!(@Ba!(!(c@L"`??@"`B?"`@Lאc?$"`㿈 '@Ւ쐐6 aВ@֪ 㿠!B#B!H !Hw ? c("!H 2? $c(?@ִ?c("!H㿠- #B!BaH aHL ? #("aH 2? $#(?@֌?#("aH @&4aH㿠@s ( @\ (?&  P& 㿠 " @g  " @a  `" @[  `@U @S㿘%6 @L@x` ?#`@ @ :,@@x@(Ē㿠6a"&`  "&`  @ 2  @ 2&` $ 2 &` 㿈56 @) & :@ @x  ` ?#h@Ɣ.`@x @(  " $ $% $& $& $mBa"@K# & $& $@ry'@(Ba   3"3@պ @ջ#\ #` #d    @K㿐'6H@)?Ce=`"' $,#`$@Ռ @x)`  ?#`@M@ :,@@x5@(  $ 2 @(@f@(\$Bက @K? `В`@!$A㿐݀ "Ӱ "а @r& @r&  &`В`h@2 " " "  @ @q&  `Вp@ " " "  @ @qے&  `,В`x@ %"} "z "w '  ?#`@Ԧ/@@@̐?36 & & a :`  &  `K-В@ɔ D+Qc耦?"M "J "G ''А ?#`@u-@ԯcL  & !Q#H9ȍJ' 6@' 6@ !Q@& @# &  ` В@}  &   А`8В`\@/!H" ,8(P\\㿘N  R3Π     cap  /  /`@@ M  耧 $ 6 ""ݸ ="ڸ ;"׸ ,"Ը % M   π "= ; ,M   ;"% =" %  / @@  %   *`@M    ; =2 M        ( @"M    ;M   x %   p %  k ; /`@@% M   \ M   W 2S  % P + @@"I M  F "2M % M   =  9 M;"3 "0  ) @@"* M  ' "&` ? #`@+.@- @H  M  "   ѐ @ @Hٔ Đ@`@Hϐ  @8 J Έap)   J  *`" I  I `(` 2 I ."I  * @  I  *`" HH `(` 2H ."H * @ H + @" I  I (``2 I `."I  *`  I  + @`" HH`) `2H `2 㿠#Ba`9@H!@o`?a5@Hy$@ң2a  -@Hk(%( dd@r ``* N N  .$@oA .6a `@HI!,@rn2a "N @H;0N `."a@P@M$ a"@H ."a `@H!a4  @㿠@B 6#אD `2 @n`$  n`2 Bက 1  8@G`* `2 @n`$ ` `2` Bက   \@G` $  `H{ א q 㿘#6a  Ф@А@tm ?#`@ё :/@tya@$H"4& @n . -`" @ .a@$0 @`& $ `@Z#Ya㿠N``/` @х@ћ `㿠6 :  `2   ڐ 2& 㿠 ``@'`  `@!  2㿠Uc@b &``$     @2 @ 2 @ $ &@( @(@E$` &` ` !2@-  .  ?#`*   @ 6 aܪ `   i 2` $ &`-` &@+`  ?#`&  "`- "*@ >" $% @Ю%% $`&[SV  @в %` @Ќ`` @Ї @&`%-` ` @m@К%  ` = ; @l@i @1. @)` ..  &` . .  .  Аᘒ!@ $%Аa@$W㿠&@@W :   J )ΰ!p ,@,`L  *# 0  L `( ,`:& 㿈!В!@, 3B@c(;Жa @E@ !6$!@pu΢ ap 'N`"N N`-`@ N  N (`@2 N N `#N `N *@ N ` N ) @2 N N `+`@ N ` N *@" t'N `N ) @ N  N `-`@2 N N *`@ N  N `( @" BN N + @`@ N  N * @@2 N N (`@ N  N *`@" N #\N .`@ N  N `+`@2 N `@N *@@ N ` @N (@" @N #``N + @@ N  N * @@2 N N ,@@ N ` N *@" N #d`N `( @ N  N *`@2 N N ) `@ N  N +`@" wN #hN * @@ N  N `+`@2 @}L `.@ $ L`( @2$@kEh&@kA& @k=\&` @2 Аb@{ "& " & P2!&@k& Д!ܒ" &d(`@:!@ &@@n7@I㿘173 3`b-6??? ""`$` *`$N .` ``#\`#`` #d`@  "`$ `2` 㿠;6a `@!{a[#Ba3Аb,@C@ -6/ВD%@ %@͔H+B@͟c(@C\ Аl@@k Д@А"@Ya`@!   @r"B@}c( @C8@Đ6a@aؠB@l( @C'a`@Ccb㿠6a@ @r`  $`2`$ 㿠!6!` Y!c8@ ה @!$!㿠 #B$c(?N F  [  *5 ?" L`-L`"L` \"" &L``"3 L` / "`L`.2`@"! "`L/` 2L`M``L`` "M`L`.2M`@" "M`L`/2M` `?``*``?L` /" `?2O L`2O  `? ``*뀤`  `\O L`L` "˰ +`' :`[L`2 `g" `L```[  " L` .@" L/ `M`M``] N`N ]2" M`N 2M`L`[o` !  M` ^  2`M``+`:   ``\`M```+ :`HM```-`/`- 2L`M` ]"L`M` ` \ M``  I L`  `]L` `]` M```]`\"``]` ` +` `  2 `M`` ŀ [L`L` `" J " J `*" J ?" J ["  J ]"  J  `2J  㿠#'N apТp`"N N (  N N (2 N `d N "N N (`@ N ` N .`@2 N "J N +` "N   N  N , ! 0  N  /``, N "- N "N N -`@ N  N `* @2 N " N `b2N @t 2N  h' -$` ' К (' ,' @G  B''`"+B a '`?''&$ @!   t  ) 2` k @ ` /B;Bc(   x@M͒@Mא@N@ɐc@@ x "В@?Ր @   "x "n)р "S/" 7Ѐ р 723@? @ʚc@? @ʞ`'ѐ @@@M0@? @ʃ`4@? @ʇ`ѐ`P@@@M}`@? @l d@? @p`+ѐ`@@q@Mf%@?o @U@?j @Y` ѐ`@@Z@MO  -@?W @=Ԓ@?R @A` 1ѐ @@B@M7  2 x@%`@?: xђ@? '@k   р "&x'7ђ@? @@? @``5ѐP@@@L`@? @ad@? x`2 x " x@ߐᐒ@> x  ђ@? @}  "  "'%Ѹ!@>ِ @ɿ!@>Ԑ @Ð``/ѐ@?Ē@L` @ @f!& 2Mx @ ['" @ڒ ]5 "4``'䀢 "`@?,` /@?bX /) ` K . /+`K+``*K+```"x @?q"h x` "x@?hx@Obx@>d @n x , 9ђ" @?:, @:`   "Ux "95;р 7"14"@>= @"☒@>7 @&``ѐ@?'@L")@>% @ "@>  @`3ѐc@?@L '@> @$ , @>:@`%ѐT@>@K`  @ې#d@=  L  +@ΐcl@= -B !B!"M`@>ҐM``/0 '@@   @ ?#h3#(3c,c@!"! @>#! "ђԪ@>4!@ȵ ?#h@ҒM / [-M  ]H` . /"(`H``2H` ](`(`!"! @>u ! "Ғ,@>k!?9Ґ  H@>@ ܒ   T! "97XҀ 7/QX@=N @3`\@=H @7!Ґ`@>8@K-@=7 @ @=1 @ ! )Ґ @>!@K3@= @` @=А @! 'Ґ@> @J`-B@@= -B@-B@< GpE ``A p "  $! 2 $ $4@=  $@   "%Ҁ "!%5ҒH@<ΐ @ǴL@<ɐ @Ǹ!-Ґ@=@J` Ґ@ǜ@< _ `$! 9Ғ!@< @ t '  T  ")Ҁ &D 5Ҁ 7"+!/@< @kᰒ@< @o! 1Ґ!@=p@Jea7@@;+ @#ؒ@;% @!/Ӑ@<@I )@; @ $@;  @! 3Ӑ`P@;@H 5+@ܐ``@; @ߐ!'Ӑ@;@HӐ (5@Đ @:ؐ !  Ӑ@ŵ@:ʐ "yp`" $! 2 $Ӓ@: Ӓ $@;j  $@    "N! "=;"Ӏ 7/ @: @`@: @Ń!-Ӑ @;@Hw0@: @f4@:{ @j! Ӑ`@;ku@H^ap#@:g @Mat $@; e 9A@?a@:T #܀ "n`!1Ӓ!@:E @ N    "O! "=%NӀ 7"3G@:, @!@:& @!`Ӑ@; @H a5@: @@:  @! +Ӑb @:@G0'@9 @ߐ4730@: `-A@АbX@9 ` `` ``% `!"`)@:Ɛ"``` *Ԁ 2  2  ;B@İc(#Ӓb@:k ` 2C`BaЀ 2>`@@@ - 3`@Z\!"@Z@!3c43#8@2`3B5@tc(@:/ @g!!Ӑ"@:h@G]p  @J⨪@f`@:  )@=b`@fĐ @: "@9J `$؀ "!Ӑ@(@f@9  +@bа@f%@9 @bܒ@9& ؔ#`#\@P@aj `ؐ"@P   @a?@E?"???'@ߐ B@#(@9 @ݐ!%Ӑ@9ޒ@FӐ @(1B@#( @9!ӒcH@8Ȑ @ɐ@F""@耥? Ӑ L@9k@Ù#X@8 @Ý!`Ӑt@9@F J 2@ë?/Ӑ c@9G@v㐒 @8 @Ø? 2!@m! +Ӑc@9n@Fc!, *( *@Y.1@ã# 3B@Vc()#@9  *7@cĦ  @9@^@c@Ê *%;Аc@ -Аc$8@ Аc@h@  Аp#@  (Аc@ ?@>@ x@8x@4T@0x9ђ`#@!o [@$!@ A!@ @!@ @!@ !$$$$$$$$$$$8$$) $ 9B@Z&  @a[ ;d!@# "@8K ;d@a @a<`2 @  `" &#`/  #`-<`@Qѐ&`&@EV" &`&`@EH" ?&& "&``&`  L" L2 L@`" Lx@”2 L @" L`` &@_r ?Ā  `@Zƒ h@L` @h@WԘh`  @7@`"'d`'ddd@Dܐ2 &&&&6*@?@P?̀`"?`d& ?@P?̀"U`?̀@Q`@D" , " ,@ ԀԐ`@7@D , @^d  "@N9  @] 7@ Ԁ` Ԑ (@7@D7@t8d @7<?Ā2?Ȁ2@Z( dԒ`X#\ @7'@  2.`@Pd Ȫ $ '`@Pd Ȥ`$ !"` Ԁ@7I`x@4  @6@" `B@7(Ԕ@6 ``" & "& "@O 㿠-7Ԡ$;B@` &``&`` ?&`@X@`Y@$a`"&@@ @7&@ W " &@@ @ &B&Ba@T B@( Ԕ!@6  @ʐ  @6@`&`x'()B›$     ``耦 #3@a0@6 ‪% $ `' ?&2& &&@C2&` &`X "('%<'$ @OE " @]F $`@U@W&`쀢"C`` 2?`@ђx29`       `"` `` @d  @8ap @6 ` @-!@5  `@$ @5` ~"o`"`P"} `Z`  @b @5 t`@z,@$` #Ԅ '  ?#`'@e쀢`@7螐 /@אH `@5 D`@͐bp`@5 @A`@G? B@(Ԕ"@5 Ԓ"@4̐ '`"%``2`@`@5n `"` `@"`@5] ``2` `P""` ` ?"` "` @^Q"` `T  `X ``T``"`` @]  `2 `@`b@5+ `"``2 `耥"`@`  Ԑb@5W@m&@S@g6 &`` •&$‶ 6 "   6 @ " `耣`" @ # @5 ‖" $ Ԑ\h@$_'ܝ㿘#Ba"l? Ԥ #dԪ@NEa`2Z`@ @``$   ?#`O`/O``/7O`  /7`\@+a`T@$a "a@4ʐa`@4@^  @cВ @4r` ?&@[w @S5@ @S.@``? ?` `?8  6 "㿘` &`c ""/B'Ā+B`Ȁ" $  " @] '@U @4  @8   2  $J12.`"  $`  ? @ ``2 $?B@1(՚ $@ @3 ?2@ 0`P2 ` @ $ $@3А  &` d@@MK "2 6~9&`ؔ (@ @ ?@ @@?#B@` `''$Ha "`]ؒ@Ԕ@ "z Hd @Zd` @Z@U,Ԑ@`@  &耥"d`L?@@%|@`@D @3Q #@}`l @3H@Ԃ@@u`* $ 2``2  ؐ@ƒ      ؒ@ѐ " " "` &`@@@@@@=` Ղ@@3;`` @L` ` @D㿠  @<```@6`@4  & "&`$ 㿠 @"  `@ @ 2 㿠@Y (7&` 7B (ap  'x  $ `-@Y&`% ! & "K `+`&@?Ő& `# &`&H` ``(S`J ̀`*@$ x`I? 2x`@(x`@2W   `Ր @2` `H * @ `K` -` `I  *` `H  A`c@ߔ ,   㿠 @y @v@X`#3c<3@3ՠcD@Bx Ւ`@r Ւ  @1 Ւ @15 BՐ`@2$㿘( @1J 2@( @$#Ր`@! l@ 7@ @ J 22J @ `3 @ 5( @ @ ``* , /`@J`0&MJ9-N``@N`* 0#`0N` 9-N`  `@ @ @Ր6@ @ 7@ @J `2@ @ 㿈7㴐    ?#Ո  #`1 #\h !  @ Րa$@f 䱒@Z 7@VE @NJ `2@E @A 㿘'Ր, @; 䆒@/ 7@+ @#J 2 @ 'J `"O`J Πp `*`2O``O`  O` (`"`O`  &.@/ΰpO` ,`@O`(`) " 0 .@O` +` 2@O``,`&.@@ &@ 㿘/Ր4/G@à @ 7@ @J `2@ @ 㿘<@ @ 7@w @J 52J @w `2@p @l 㿘6@]"Ր@@a 㬒@U 7@Q@ @IJ `3@@ @< 㿘H@6 げ@* 7@& @J 52J @ `1@ @  㿘P@ O@ 7@ @J 52J @ `1@ @ 㿘%ՐXV @Ҧ @Ɛ 7@ @J `5@ @ !`Ւad@  Ւh@ &`Ւl@&`at@  &`Ւ@ &` &`@ 㿘Րa @| ǒ@p 7@l[ @dJ 5@[ @aՒ@ `@M`@U&`@H 㿘Ɛ@B ⍒@6& 7@1  @)&J 5 @& !B $#( @y &#(`@& @  㿠Ւ@  N ` N `τ`p) :  I㿠@   , N `x  N  s N  N N  `r w`?(`?*`  , 㿠@ J " .J 2N `.N  N  ". N  2N 85#`@ #\9B%@o#(ؖ @.* #h @Y#dd!(;β"ap#xa@{ #@jKa@Ő @`A''J - )Bd l"   !'"$`/@.0`!'"`@.&a`!' "`@. `!'"`@.`"! !!'!'!!'"#t9Ր"@-#t#!'"#t7@-4#t/ժ?#p@ #l@Y     _`C  @  & '%M +  N & "`0@7耦 'N -`- `+@2N  !#l Օ-@-DՐ #p䀥``M " MMM#0. (`"`0!!&0`y-ՐP@-}sm`M    * KM (`,M@M,! 0  * @,M:3M -` / KK/  0  * / K`:K +`,MM, `0 `) ," !!-Ր\@-ՀՒbp@- c@ ,`@x%"  - Ւ"@r #pq@S !'"-`@,-`Ւb@ƐT1Ւ"@"O!@ @Sr'@`=K`/ +!">@,9䀥J @ *!",@,b'䀥2$ I" M*2-!"@,b #p !  @,Ⰶ #t䀢 `2 ! 2!! #p"p@,ip KtHd2 h@S #d#h@@ d% % '@R h"``#h @1 h# @u '@`''l''' $  %'''̪gl?%gl''''@h @6!"#@,c䀢 "@' @!@@V\@K\d@%՝X9Ւ#(@9 -B@(7Ֆ, @+ @V  < (@R '!B'!`Ւ@+А#4Ւ@@D@Q #զ cD@; @HդH@4 @A Fբ dL@* @7 ը#P@# @0 " MP" !`  ;ՒglcT@+'?''''''''@ !'쀦'Ւ+@+c@ J  դ㔒@ J `J <!! ''耢' @+b#@'!!''@+Sc '@Q @1 % %'@Q &@% &@R@UِV@~㿠N  R  ,",  D"  E"   B"  W" B    " @+c N `2N X;֒`@G ;B9B3@#(` @* @U @U@U@Ux( b@o֒@U"a/֐@*ҒM`"NM``; NN`;2N ;".@֐@#֐% @`("-?@Qza'䀤"M?@*0M?  a''耢"'@*< 'a'"'/@*H'5֒P@ 2-aa+@*`T@@Uֲ֒`@aa ;@*i`a3@*``p`֐@*W֒ @ː a`#֐`@*K@А֢@ ɮ @( &'*@⫨ ֫=!,= %(&(%@ @a"'l%@*0֨ a@ @ @N`"NN: N`N :2N"N@N"NN : N N:2N"a@ia`" '5#\D@)Ԛ''?'''''''@La'쀥 ֒%@)x֒!@3 ֒a@/ ֒@+  a-@)a(v'a  ֐!@)  '@P< @y &   & '@P0 $  @l $ @@T  a@)s`@㿠` ``*, ր`%%ݓ !@ B@O(֖ܐ @)  @@$ 0` H 6 @%a@(  㿠)B 􀢠֒b@n2`('B)@("  @(ڔ  `( 3-@C`(`,   @C`,  @! @@O 3H3cL9;39֘cP"(@B@  #@#@O0#֒b4%@+h1@'7@Ðb` `` @֒@@"` `` @@!(+3"c  /֒"@  ;@ː   bl)  @ @֒c@@}c@ڐ  1ր "/7@l@ɐ@e#,@<@]@@VL@@X`#\` @` J`/ ` |$ֈ $* ` ct@` H   o$ְ$.cx@   c$ ֒$*#|@t  7 W$7ֺ`$(`@d ֐@@T@V`2  @G  3$ $) @6֒c@4@ 􀠠@)@=  /@b֐ /@]֐ /@X ֐ /@S7֐ @Nѐ:``@8(J"@   H ) H ? `+ 08  @ 㿐 . @ @   `Ք `@ .= ;(/cǔ * @@g N  N ` N  N  `"  .  * @@C M M  M M " ,  * @  L` @L  @L @L " @,@ !] * @@ N` N  N N `" , ,: * @ڔ M M M` M  " - 7` * @@ ,`B֐c@&Œ㿀@-(  ?#`@А@͐ ?#`@@7@-@@-@-@ ''@x  & @, @,@-'@'@_ $ 6a͒J  H`  H``2H`    J  *` ` &J 㿘'6#0 (`  ?#(`c "@*+`*א c &@.͔c '@@$c $㿠%0 $'0)6 "(`2!"( $ $$%"(N`- $"(N+$ "(@"$$"("(""(M` `22  "   "   􀠀"  $ @ *M-2   + @M`  $  &  $ @"%  ַ-@@cؐ2  `$  "  @ "O $2$ $$$  2  @"?$ ?.@ H`-2 -@ K    + @ M``-    (`@ %"("$"( +@N`-2"( -`@M-`""("(  #\ L``" L` = `L`L` =2` # "("($@@g 2 @G "($@`2     #\   `2"(\`0$9B5@!ܒB -@ @Mb@"("(@%"(  $  ?`y` `$ L`"6``0`Z$c$$ -@L  - @ĐB1Bܐ"@`9B5@,!B b-@K @ `@"("(%"( ?`*  0 `$ (`@$c$ 7B@`\B . @@@"("(%"(N :ɠ ? :@"("( %"(2' `"` ` `$ 90 (`@L`- 90"(L 2/"(90#$`#%3 -@M- @K`B+B"(@b%3 %3@> BB *@ N`"(@b%"(  $  ?`%"(H`Β"(H`   $ I :"H%0J :bJ :2"("(M " $"($ $ %"(%"(J "  "($ `$ "%"(0$  90#B@`Bܐb@F'#(N`:2  ? : %"( $ -@$%"(%0$ 0@͐ BBaܐ@&0"( ?2 ? $  ) @$    ΂TT     G* * @ 㿠@JH " " $  ( @: :`$ $  @J6*$   + @ 㿠@ @㿠   @   * ` - ` @` ``2`  㿠 ؒ2 㿠ϒ  &"  &  㿠@ 㿠   +` @p-* $ %>`? $  @Iđ( (@ '$ ,`  # " @@ * ` @`` @ ` `*@㿠    @| * `@ - @ " ` 2 $$ `& $$  㿠:2   -` "  %#&    `) €@/ *   `@ @` ` 2` ` `$ 2 㿠  (`@p & 㿠   (@"@@"`2* J ` J   *` @ HH *` 㿠 @" zczc}J Κ #p @`J *`  @ H` H *` 㿠 @." {`<{`R㿘@H P/ P&`    O$ `- @H&`% ` # &#M`/@`&@.& ` `& ``&J``*2A `N` 2θ   `M`  @."- ?"* O "  "   ` + B`@J B`B*?"  אa@!z` `" 㿠N`"N`N Πp ` @N` @2N``N`   N  N` @ "`N` N `: @?ƀ 㿠N %΢p , `- L``@L`( 0 `* - @ @L@`"&`  㿠@Gݐ&` #D "` J  "J " J "J ` H "H "H` "H` "  "` "㿠 @  @ .`@ a גa8@ h 㿠2`  "  (` @``?#H `"   6" 㿠@GM    ` `& & @G9,&  &     @n  `& אa@L@_ & 㿠@G  " " @G $`$` `@M 㿠@t @r㿠 !B! & !`"  T@ L  !`אax@ @㿠 #\@А\㿠'6,`2` 3 $,` `&` @F,6Bက  פ᠐!@ ` `  ֐@`@ ` @&`@ a㿘@?'6 ,` , Bက " ג@ޔ  $ `  @!Ԓ @@l`2 @B@x@z  @a@p  `z㿠 ` B Ԁ   @! 2     @   אbגb@k!0 B㿠@ -%Π @p@?`?M`I `   ?  #` &`& O  /``ۀӢO #5& "L`L` *``"L` L` +`(`O  (` "0O ( (`: /`O `* 2L`/``` גbT@ǔ `O  ;" /``" /`O  `+@`/` `v` ג"X@ `O ;" /``" /`O (``/` `Y` גb\@ `O ;" /``" /`O  `* `/` `<`  ג"`@p `O ;" /``" /`O  +```/` ``*&L`אh@R 2L`O ;" /``" /`O ( 2L`/` `O ;  L`/``*O /`` % @@ .``& @&.` @"  ` @D{&  & @Dk @ & & &   @ & 7     ,&  &, "   @DK&  & @D; @y & & &    `@@n  . @&   L`LΠcp ` ,  L 2L 㿠 "  &@v*   @x  2  `    l(L㿠 'N 㬦  p"   ) @`!2 L  `"`-` $` `(L! `"L` "L ` `"" `'"  `"z `>"  `s q o ,2i `."f `-"c `_"`  ^ `+` `." L`-" L`_"L M LI `',``"Lי,`L ; < @2L 6 3 @@L + `-?L # `-2 L  `-2L   `--L  `-  L   U " אp@W!,`א"b@P!L א"@I!Lאbܒ@B!L@' #'`'''`!'#`' '+' ap''$@} < J   !2 J 2' / ת L . @2 L `."  L -" L _ L *`@2 L ." L -" L _" "'L . @@  L `* @2 `"L `>2`o '  '  L ' .@"L  sL . @@2 L `/2L  dL .`@"L  YL . @2 L >2X`L >"!L `+`L ."  L -" L _ 3L ) @ 2 L ." L -" L _" "'`L  `+`@"L  L .`@2 L . L .L `-L _L /}L `>yL =2` L `* @@"L  L .@2 L `""+L L '&L *`@L `> L (`@L >2 "`' ''7L   N"L ` `L ` `  N " L >" L  L ꀠ`L 2'' | ''''Ā`   M  .& &.- .$* @AI @A9'Ȓ@wȤ'- @-@&r &k&Ē"@&   " */'#'Ѐ''$'ܚ  `@@'   '  &'ܠ ''* '2@\ ''''@O㿠@@Ԑ T960'"4;B  #,#, `` ```` @C  `2`` `2#? ?`? @' `?`2? ""4`#@  &,`"4  "@@@ 1#    *. 0 " &   `` & @ &` `  ,@@\"" `` ݺ 6b4 㿠0 c,c,@Ò 4 ?`  *`?㿠    @@   `@&  ,`& @ (`  㿠@5    +Ba`  `$@M  @5 2a "^  H@: )B@;ݒ! ؔ `h@(@5ڒ !; `@@/ @+@?  @  $. $" + @ %@$   $N`/  @,  "  , "&  `& & 㿐? ?`!0-#0  "P @   & E/ #@+  6.2* @@2` ``"`9" `@2` ``* ` `  "  `@π  2؀P# +ؔ`  *  * ` "`@s```@:&`@?&`Дߔ'ؐ  @` ܐ `/ ` ؤ` l@Igؔ!5J  `p-`"J / J  J /  #`0, `/ J ;J  (@ @" J `L` -@2`L`!Ϫ p  UiL` `RcL` L]L` =YL``(`@" `J` -`@2`[B * " 9ؒa @ڐ2ؐ! *@˒ &`L ` ئ !$@ , @$@@&`L`ؐ`@W!-@㿀@B9 B(@\'ؖ0 @ !B)6! "4`"``!8@K``'''''B8'"4''`2"4"4H``֚! P@&"&耢 @3@Bb㿠644`"?@%4?`?@㿠5ؐ&`h@3  ?N +Πap - "L`/`L``@L`/`" 0  + @/`L` .TR`L` . " O O O   ,`2O O 2>?";?`6O ? *`"0?O ) @ ")?O  .@""?O O O  `0O *#`0, " *`,` + % 0  O  2 ? &` &`?㿠ؐp@  N :" mL N -Ϊ p-``  N ,`"N .N  N (! 0 @*`.N -2G N  `-`"@ &`  N  , @"N - NN. 0 `* - N`/2$ N `- " &` N , @"&`- K``@K`(` 0 *`- &` 㿠@ax &` &` 㿠@' ;@ @JΠp *`@ "`@ J`(`@2"`@<Ԑ&` 㿠@a &` 㿠!6 "L$`"LBc"L$"LBa@a㿠)6"P.`4 "P􀤀'@Bက`@a  %5 B%%"Pa ذ"@ؐĒ@\!]aؒa@U!b5㿠6P.` P0  ` 2   t@=Ba@=b,w  㿠 " @H  " @B  ` @<  & & & ~## `,` 'غ B''  #` #`#`##'?'&`&`&` &`&`&``2``` - x2`"`@̐\`` @ 6bD d"'ؐ|@ϒϒ " 9`` .2`Ɣ 0 c&1B 3# ?# `( "@`( -ؐ  ?@A Р@`(3#`#` B@AD`   ?@& خ"@`B᐀)3@ t   ?@ #@ t (@"   ?@  "#@" (' ,' @ܖ 쀢`"?'쀡 "?' `    '@ ⸦ @2u @ ܘ@H`  $" `( ("`( $ ( `,   ` %ج @ vȤ@/   @@  )ؐ ?@ В"ܬ@V  B 3# Ā"     #@: ##@2##"#@## "#@## "#@## "#@ ##"#@ܐ##"#@Ր##ĀB@ΐ#B #@?#@@@@@@ @#@@  Ē @ @@ @Ȑ G ?@" 3Ѐ3c؀ 3܀ 33 3#耤-3쀥3/B/3?)#`#\")B#d#h#l#p#t##x#| @! ؐ0@6@I"@D@>@<@=ƈ3-%3?@ @ʔ?''Р @ # &@  А@̂@ < ̂@`J4 #ؒc'@ @ΐ㼒@ ̂@@`  @ @@ d 561ؐ#@ÒP`" ;6bD2  .B|`̂@@`@@9V̐@`@ ,,X̂@`Ȃ@&`?0Ȃ@`J  %@nP@9G&`!@9B&`! Bx  ق@d` @$ق@l` @̂@`J @@`$@9&` -@88@9&`̂@@Z`ق̂@`J %Bx"  ٖ t @䀣?B`2ق{@|`䐐ق@``` ق@%|` `` ق@|``~} `ق@Uดh`nm`/ق@|Ĕ``^] ق@`؂Ĕ @K"Ă@`C &>ق@``⤂@," @`#$  􀢠%ق@/|x`  ق@`!t̂@@`m@ْ@i 䀠"`" ; # `` +`2`YV "'@V'@0!-6%ِ4@1P " 6D 2b+7@ )ْ!|@=  ήpK +`@@7K7٢ ' #@!ٺ 5@!\@ @D 5@ @  @' -,--&.,2 ,2`` 2 ` &)@!̔@2`&  & `"- ")`,@Q . @Ԓ!ؐ"-ْ@͐"`,@``,`@7F `,"`,`@̒ &2l`?܀"k&`` 5䀤"3`$`&/`$ @b!@w &`&`   @ @{@X d)6ِ",@Y"P"3 )6D2. ) )`$`"0&`+@2b<`,@   @Q @L@) d`;65ِ@*bP " (!6"D2 ([ ( 1`" 䀦?'?#&`?T"F"B \ 2>@̒@ 䀢?"?h@6bX=N` ~9N`/5I 0@-"N`H/2 N` ``(`H`/ `N` /`L /"@`@*@@ה /,@(& @*& 㿠N`` @*@/A& @/)& 㿠N`' @*Ґ"  @ $  I?`/2  @( `2 @/& @.& 㿠N` `iN` n2N`N`f2 N`N`2N`& N``@N`ΐap /`@, L``L`, %`0 L` +`, @/L`"L`L`'L`Έp `k `"&`g" ,  ", `m",  & &@3b@ & @)b@ 㿠N`  @N`7Άp -@@-`L``L`/`$0 L` `* -`@GL` "L`L` ?L`΄cpm "2&d-`h"-`#-`w"-`ۮ%-&$,@-`&+ #@, ,`& )  *` * &@b@  @bȒ@ 㿠!B ۔2  ` $`$` 㿠N` -B`"8%@4%@%@'B)Bܐ"@ !B! @!@@`@)7!$!!@@@!@  (  !*@!+@  㿠!B! !`B a㿘'Lu2 B ` `?  㿠!B X2  `` $` 㿠N`  @X  @(B ᐁ @c0BBaܖ@_ J  "J J Έ!p `(@"J (`J  J (`"`0   J `* (`J "??㿠N " N N `:"MN !Ψ!p `+@@2MM  M: M(`@"M`:  @ "   B`@㿠.  6 @"`(` (@ T"$ X@ T$ T$ X㿠@z!6-2"\%"\%+ " `P*% -`  @(s$`T`T$`XJN@S,@$`XBN.&/  @(`T @t`T`T@($`T`T@6`T +`T$`X"N@` P@' $`T`T@"`T@`T *`T$`X N@@,@$`XN 2 $"\"\`%`6%㿠N `@A  @$pL `㿠   #B "/B8 +B8t 48`p.'Bt )8`p#8B耣@ 2B"#@B䀡 22a  @J$? B!䀣` 8@c.2  `  @Y? , @'G& &     @'=& &  r 8#@Ӑ 2@ 2a  @8 c 㿠8Bc耢 ccBb"c@c$?㿠!2!  8$! c  $! 㿐'L 'P'T'X  B "%B8 !B8t+8 p`%B`t 8p 8 B!耢@Bb" @  UL㿐'HB'L'P'T'Xက 8 B!耢@Bb" @ 0H㿠4#4@8"ccBB8"#@#@B  a@z`@ 㿠8 B!耢@ @B  ``2? a6 b\㿠-289wXw\``6 w\,`%@-&.`X```X@Β`6 @,`wXw+`" *# +` )  @( * @@@㿠%B䀣`(!8@(NX@d$## BB@Ac(BB ۘܐ#h@BB!$#b@@I$㿠ےct@ ےcx@ ې|@ @#㿠@cBa@Ɂ۝㿠@c3!@b@B@R @ D@M@a8@H@`$@C@ݐt@>@ؐ@9@Ӑ!@4@ΐb@/@@)@Đ @% $@\h  , d ( `x 0Lx `   4 P H D  |  (DTp`|4Pl $  @\x< `-B@ /%܀2`%ܶ`%E#52caڊ ?t5'l `? fd/ @ƀ`Y  R/K  D%=;a 67a$ڒ0/9!4Ӓa@(+05c̐D!TŐaL!X!d/ht  !x%0;a7a9!a+5aa۔!!Ԕ/x͔ " qƔ%j,;b0c@7bD\T9"XUb`+5bdNtGbx"@"/9 "2%+;`d$ly7`p|r90#`k+05cd0c]/0 V0 O 0#H%0A;0c:07cސ390#א`,+05cА%0c/0!0! 0# %0(;0c407c<)0# aD509!L0+aTޔ0#a\ה/0ǔv@@Ĕ0h0 a!0%Z70;Sa90#La50N`N`p`d `H‥`c"% e‥`k"09^&;‥`r%‥`vU/a"%a!!  b "b,N`2NN+05cxG0/#@0c90ݐ"2 0#֐+%0ϐ$;0cȐ07c09c"+05c0/# ?" ?%BpBB@a<B B?# ἀ "pB2 p  '```"'`p?2 p+B `t`" $ppBB t`Bᄀ +0B `+0c BBB| @#!.   ?#`! c (`@@ 9c #ĵ*`@@)&c ,`@"4@&c  %c &c  B-3B& `a 'B 3"6O(쀠1 O`- O `-B%`# ` /64#6`8@x%`` p`@@p  <3 @   %` @  '@ @  @ߒ   @ې  `Q "'l+B4`-B`'h`" @T "@ ,lhd@ ,`" h@#l"h ؐ@Đl @9l" h@() D h "l@l @2'l3B`` B`B@K``  B@P`]  B `5B`5B9B!h!h`.B5Bp#6`< -)B-!h!h@'2 @kh@!Ґ B t0@B@Y B@&a`  B̀BB!` Bᴀ @    @_ &  `"" *@ W/3579@@;@"@c8@ڐc4@$@@ ;@ o+%B@adܒ@[@ b@"0@N@bPT@@@Ր ö@@ڐ@@ǐ @Ґc@@ :B@ȐcH@@ :+0@@@ @#@{@ 2B@@ `8!@  6 H 〦 6P6X@`Ē@F@ X@b  @] @Z B!`)8#'!B#B$c, %#!B@+9@`;6  ?``#`@@qx@!B@$c,!B#, S`"#,K#,``" ` `@e`` `2````" ``@`2,&`&&``#`&` #,     2   &` &㿠 ```` `@`@`@` $` @  @ܔ & &`J  J *  J `2J \D(㿐) ''!@#\9;B@!%B@c('Bܒ@@#G 5##` +6a`|-Φ 7Bp9B` 2MM`" M M"MM) @`@M  M +``@2M#MM`" M`*"MM "2 M" (` @M`\2pM "MM"2M (`@"M"MXM-4 ,@`")6@# &  h# @ؐ" "@ΐ"`    ` )6  @ݐ!ܖ@6  DM`@ɐ ;Mh@ڒ1M!p@ 'Mx@  M!@ M!@  M@!ܒ@M`2M@`@"7\#`@\@'` ' # ''2㿠  " @  `" @  `@z @x 2 㿠3b@ :" @g @|  *  㿠3a@c :" @C @X``*@C8 8  !#2 @ 8 c 㿠!8# # " ``2$# $# ``@8c`8c` 㿠@  @۔ & &  `M#Ba@Ma @ @>`@?` @#{  @a6 o !jܨ@  %   & 6a  & @l& a@h & @Y#d #`bb d` @L#\\h'㿠 &@  b & 㿠!B!@!  &  O  b$ `2  @:  >`  @ 3 0  & ! @ &   @ @2  @ $& &    @   @&  6  㿠'B??@sᬪ  `2  9@h: "( >   ᬀ 6  4"0@א Ӑ ᬀ &  `"  @@ @< <  @4  @  @$=b8 F @㿠BN BaH;b<@ $5B  2&&`&/D@ %+B a 0$$%a#bL@ @B ᬠ 0#?# #ᬁT@ B ! "!@<b\B@b㿠@  @= $ 3$ b< $  @ڐ $ "5 @O @ 㿠  &  3   @3 3 @ & < "  "  <  &   @ &  &`2& & @ @㿠 @@ b @~ @~@Y@@㿐   @!Q@~ 6 `"`&    -#`0 ` F ¯N#\\dD @ ` @~ `bФ @~ `:`  6`#d #`d` ؁ ^@#\\@ [,` `  > =/ '` %`4/  >/  '  ] /   &/  ]/ < :,`"@A $` "  [ [$@,`" ] "  < = >  @@(`@( `2((``@뀠@ ]( `& )@ "@~|@~A`  ' @ ْ3"@c)  #`#\`@~a\@~&   @}  $g  `$c #d;$ha8+""" d #` ` B ĩR#\\@~acŐ : <" ,#+`, $@~T`@ =?`&@, &. '@c 5 -   5c @} 5 @} c 7(@~ 3c0@}/@@}@}  $  +cL @}x   %$   : -  -     *- -  "b@}W"(dؒ@}O":޶ [c\cx@}H" 㿠ca _ 㿠 Bc@}<B8 "B` B@}"@~ 8c@$ -3 b<㿠@# -3 b<`@} "   ""  @ ?"   C㿠!     && 64& H.` 㿠#` `"` @|` @&& " "㿠@b  @| @|Ǟ㿠@N " " " "   &   !B & !"!c! "   #  "&   &  ` & 㿠 2   &  #B&  &` & & "`& a"a X a` cO @|e x "!6 @ '6@   @& '@ p ` 58"'"'/Bက = δ 3 -B'%@  %`" 耢 "2 얋 "蔋 2 耢  @2 @ѐ@{耥 '& 5B@  Ba ")B@" @2)B  !` -< "L'B'ABaX 䀣`@ "8'B@I  22$" 0"@"@A`@>Ɛ`@c2 @@͐'Bᴀ   3@.Bက" ᴒ`I ᴀ@{1@{+` @{ B@{.(   @@{@ "@{:  @{4 ܖ@{(܀ @{"ܖ2P@@@ = " 6`" `l@z͔!9X 㿘 +Ba`a`/ْ@" `a"a7̐(a "``2ad`2 `a"a%Da  1 ` a`"a#aha2 a "a9!a",P`2'P`@z2!P ` @2P<"  3 2P @$` 2 Pa`"a` !h a2` L"`$` @\ 2 `$a`"a ` !P{aH"*`@1@z."b@z( "`&`@`$2 `a"Va-`$$Oa`2 2`@zD`" a`"=a`"D `6a";a`27a`@J` 2`@d @@z `b@ɒ `` @`@2aa  "ْ@Βa"  ϐЁ ` ǐb㿠@ u )@ p , @\ @y $ǘ@K@I@y  B!` #$@yu"JӐcc@ym"MА 㿠N  N``N`N  `N  H``H`N " 2N  `2N H` 2N  "N H`"N  `2H` /2 `H` /H` H@y'`?㿠@y 8ct@yC@yA 8cc܂̴㿘'8  2 $ 2  $ ˻@x/z"  ˾ 9@y@yǐ˯@@ @@cTc@x"㿠#8c c 2̜ $c 2̕ $^v @t@q˷cc@x#㿘!8# # 2m $# `2# f $# 7 # ƒ@x@xT㿠Ba!8@.#$#@@㿘@z 387 c@#c&cc`f `  #B@V2X`@=2 aa "K`77E`-Ô /``3`"'`#`"`@'`'`a "` `2 `"'`'`a "```2` @@ ]``2`@@@wՐ`$#d d#`#\`\햔@㿠!8# # `"@# J# $# `@A$@$㿠` N `* &&  `L@w̔  &&&&㿠@N`/"`@ &   @$  ` &   + &  *"@ *@* &   ( @(`"?"?"?㿠      ``   & -  $@-`     `   @#`#`# `  &   @wI& & & `T``@w   㿐'' @Ð  @w `7;  p`t`h$@wK 2 M `*`@ M(@ @2:M`#"" N`N *@@"`N``#@`@ @N * @@&`@ N .@2&`֮M +`2M-M-` 2M-"M `+`@ M * @@2|{BM`:v@M -@@@`@ M` `*`@2`@`@*`    @v  2%@"J   G`@vh "8   03`@vQ ""    Bက`` Bက |$`"  @  ( @(@ &  & @u͔! (㿠@ B@uc(`ܐ 둔   @㿠 $    @u@ ` @&  `@u @uʁJ J`" ΄ ϒ!p`p|%8%H` +` 1%H`) @ !*%H` 0& H`H``94H`H`! 0H` ` H` 7 0& H`H`94H`H`! 0+` +` 7 + ;`/%`%7 H+  a0 H `( !) H 0& HH 94HH 0H H#`70& HH`94HH 0+  + #`7) ; `/  2  H``H  㿠2  `,   i    &  -  B"* a  6   6@ 㿘@u#8@` ?#`@tŔ :,@c$ 2c$א $c$c$ }  c$ؔ@c$Д㿘@tϐ@l` ?#`@t@ :,@@x8#$ 2#$ A㿠@ ;@t| 鑐 &`  @ @t`" `"```"@t`&``"`?㿠@t 㿠!8#$` #$c #$$#$@ c<@ c@@@㿠!@+#@-B$#@$#@cx\#@ @L#\\$ $#@& ` Bက #@(LB!`.` !.` @(`@@t($$#@㿠@  %B&  p p ``3`#\2/8(   @t&\"` @t<` "p?`p`"ܔ 쀥p@\78@F78(7 ''/ @tH@t` 2'?@ʐ" p"C@p"&ŀ&?p"``2 @㿐'@6a 6!(`3bP @#(#`#\`@s\@@@?P㿘5 ;`@#`#\`\ F́9 P&2 &@2P &2 &23@r ǀ aa@r `㿠@r*  `̂㿐   @`&2&`@#@a 芔@r '+<BbPᔀ '' @ `  @ K`  ``"P`@ `";!@V"#;  ڽ@4p @rzb E@)`@@r 4@ria@, 0`@@r 4@rV!Ȓk @`@u@rt 4` z / ` + ~`%~F%~`   ` @ @r[0 "8@rU  ' w` "@r/@ @r)'@’M@r @`'ې @`4('@2 )@@r@, @qՐ"砐 @@`@@q@q %@qd 狔 @o@m`@ܐ@qې@q %@qXt @X`@ǐ@qƐ@q`` ```" ` ``` " &`&` @q@%`@& B@qB2&@qBІ` Ё@qJ!I㿐     "@( "h&-B'+Bb' 6 2S@2T 6`" `"  @  "'a,"#@"``@qː @qu" @qc( "濐 ' "@q "@q `&2'@S㿠@pϐc @pɐcޑ B!p !pC `  !!p?"`"`B!`!`   ` `!`@8` * ?@㿘%33B`aL" `aL"`@p @qv``2O` 2  "G` ` $   @qa& 9`@q] 5` "1` +aL' @qP(#` #d"0"8 4`Hd` B̥P#\\ `  $@H`" `@q-`@q) ``2$`J KJ ψp`p%2J J `"J J  "J J  `(@" J J *`2J J (`$  0& J J 94J J "0J  `J "`7 0& J J 94J J  0* *#`7  (` J `2J (`㿠N  K ϒ!p`  K `2K #@ @ tN + 3N  %ap @"LL `;  / 0 `7 ` / 0/ 7/  L/  L 2L'/ cTl@oy ā㿠@ LJ `%BJ !p *@a"J J `) @"C J `0& J J  94J J "0J  τ` p J "7`0& J J  94J J "0(τ `p("`7ψ ap @ 2  @ `2  J Ϛap "  J `@   㿠N    "` "   N `` $@$@&+`@ LU Ϭ % p|  "L "?LALL :` , 0 7  ,  0,  7,  *L0& LL`94LL' 0L L&7`0& LL 94LL#0/` /`#`7@,  L,  L $, ct@n!㿠3"d "d"d@n`@n ` ` 2` , 3 @l(`"  J ΄ap + @  J -"J `+2HH + @`2H-"H`+"H :"H `/H`/" J Άp *` 2 `H` -"`H`+2H``H` `* 2`H` -"`H` +"`H``:`?* 3 @h(*  3 @ ("l 㿠@oJ `@"` 㿠  :@n?   $&@ @ &@mԔ *&@&@ &@mǔ ( 㿠 N @N :@N /@`M` @M``:@M``/2`@2M` :/ M`)Π`!p , L   + @2 L /L `@m@ 1 @mڔ%@ /* @m@ " c@m˔㿠@na@mJ   ΄pI p + @`" I  ` @)  I `2I 㿐'' `"  &` %3,%d- @mN@ #d#`##\`"ͨ  &` M  ://@ `"  &`  :MΆapO` * @ -`O``-`@"`0 *O` M`"  &` M`/ !#mJ M;2 M/^J #d?2 McSJ #`#2M@lؐN#\`c$# `"U  &` @ K 0 @l 0% @ % % % (% ,@ % @ P   @W $#  @ d% @ {`% @ t\%    @ @2% @ ,% @ @% @lp ̒#@l5"㿠 . 3c`@l"#:. 㿘@lO  ?#`@ll@l͒ / @` &`@&@ &`@ &㿠  " @l'   " @l    `@l  㿠 `" @l ` /.`@kД " @k ;-@@k ` @k ?-@k㿠@h ǒ,@㿠@k  J `@v $"'& @k"& @k @k $@@@ @k~ /, $@kw ) _"& @k& @k @2 & 㿠@k @;& 㿠@k $@/& $㿠@kt @kr @kp   " @kj  " @kd  " (@k^  (`" ,@kX ( ,`@kR ,@kP @kN $@kL㿘@  )B@k%#(+`$ ߔ 'Bဨက`"`/`,```t ΢ ap$@kH    @ `O` * @``@  `O``(@2``@@J +`@@"`@ @J) @2"`@5@ΐ? ?@o@jېuo`D q@jʐ@jƐ@R  @j %%$` @ 㿠  `" 0  `@j @j 2 @j3B@ /ax ?# ?`#`@j͐< @$a急`d`\%`@j@j@k;$`l@j @k/@jNN / @ @"`J`/@2"`@J``/ @@j}x<  B@j$ ! t@ji@  B@ic( ߯@jJ   H`/" H`2H㿘     N   #B#B`-` H`  / `?א` &``M M`/" ```M`2M`@iŐ  ?#`@i 6 6M /`? 3a@i @i @ H  @` ?#K` .2   J 2  @i)  @iȐN  "L @i :,`@ < L  H.2   H`L  L `@il@iiM` ?#/`+`+`@i@iR" $K`/"+ $J ` $ @i= @i:@i7@ L ```ด@i_ @i@i@i㾠N 0`9N  %!p  "HH`>  , 0`7` , 0, 7,  H, H *H`"+$$:'$ ?,  H`" $$:$H` F % 2`/2 H`, `, ,  H`, `H`  *H`$a:/, @[㿠'B`   $N  $  36a  M`  v 2  K`. J " @hy @hv@` @h@hh   \  耠` @@ @1@hH㿠`"*@8`  H`  `@8H`  㿠N` 2N`@ρ?$@@ @g@gߔ,N`#@h! #"@h"@ @gȔ@gĔ,N``/H$ @h /  J  /  $ @h /` `  ` $ `   $`2$@F@g"6,@gz, /i /      J?/     @  `@gV`(",@gK,@@\㿠  " @gk>㿠 )3'3"hd+ $ , -`%(`) (`J ( ,  `6? ,@g?@g<  ``@  `  @g,  @g& @@g@f`@g@fݔ " @ :`- @@g@fΔ@(``@f  @fĔ   :-@ @ @f@Ԓ"!,`  (@  @fԐ  ` ,@fȐ В @f&Kq (`@f&܀`㿠 B  B!(!( @g !, !, @g " L "  @cD@f$,#㿠  " 㿠@fC     ` `2 ``2` #@f+a4@ @   1-B@f!D @f*(@tBሀ ሒ@D@f%B(;!@f!d@f ( ǔ@Q;a@fI9@e!7B@e( ۳@= `    @ @"y  a  q %@ @f{  "  _ "1 "S X @|@ 2 `  @*   @d    ۝@e@e. @  5`  @   @;` (v@e  b`@  2z    " ^  $     $!@e@e@bd @ep 㿠N` /@N `/S‸ N `"NN@`"NN@N2 NN/" NN@/"NN`/  N@/ NN` @N/  K 2K @ @e, !@@    @d۔ `, @e)blbx@dǔ'q 㿘@d`   ?#`@e ! @eb%3 %3 ?#`@d@d@d" 2@e@dbB@d( R@9 @Y$ $ $㿘N " N  "`'2N   &` $&&*@d’@> !@e `2 ` &&(@d@dے㿘@ @d]` ?#`@d  J `&"  `#"  ""  *J  㿘)B!`@ _@ ?+@d!,N    ?#` L F % 3`?",`L,``,`,``L 2L$@ ,`@ ,b@c(h,`   3  3 3  3 ⠁bb 㿘 !A#D2#D R'2  #D`2#Dy $#D#DB' ' @W#D㿠@c 㿠!A#D` #Db  #D$#D㿠B a@cVbBܐ @c? 㿠@dOb㿠@dD @d< Ґc㿠@d2Ðc 㿠J  J`#p`@*``J`2J`J *`8   H@  H`2H㿠&@ @b,@㿠FN `BN    . 5N  p `, -`ڒ%  %`N + @@" N ) `@2 N  N 2N (`k-$$ 㿘@bא?'A *#H#H@bA cH@b㿐@b?'A *WW@b c$#\ #`  A#W` l @b`㿠!B   @_D$ @c] @bEX@c `@b=ct@c @b* @c cP@b$ @b" 㿠N `  N /" N `.2N N ". N .  N `.  N ` .  N { N"NN`/" N K `K / Nd`N`/  J ` / " N@b2N .2NL `"B L  /  @b!  NL .2NL /"$L `2N$N/ $`%M`/2$`  L    @a``6   N$`.   N `.2 N J /2N N .J. J/N  @a 㿘''@b|? B@aqc(c +x@aӐ #<( @ Bက S@a@a9cĠB@aDc( 㿠@bA 2 `@ax" < " 㿠@a;@ؐ`@ahِϐ@a 㿠  ڐ`㿘@a   ? /#`@a'L / dL"LL`/" L I I / L`" , @a͒!?,L 㿠@aY /"x@`Ȑ @N`@` /,@`ݒ㿠@`"NN/" N`#`K` /2`N/B` `Ā ` "``Ē@   @    @    @    J `"J J` "J J`J  J  `J`J`J " J  `" 㿠 `")  C        H /    @  `2  㿠`BN /" BЀ ВÔ2? ?` ?  㿠@_@_ & & @J I    `" ! `6J  " 㿠 `"'    p   "   Ȑ   @_"    `2  㿠@_"NN/"NN`."N` " J /J .2`N. `㿠 Q Q@`e  Q@_n H ,$@`M  ` @@_I N `-  N !B@_}!  @`*    x@_ߐ$     @` $    @^$ $ ""$   @ ;  $  ,`$    @$@ @^  $ 4` 2 @^ʐ @$$  `"$  y $ $ @^@^ @^Ԑ 㿠 ` @_ @^ǁ@^ @^Á㿠 `  @^  `2 @^㿠`2` @^`      ` ``` ``(,`) @^N@^|㿠 !$ $    `2 & 㿠 $ $    `2`㿠"  @^"   2  㿠  @^* @^( 2 㿠̒ʐ6a㿠@^ 㿠ɐ`z a㿠@]@] ɔ a@g㿠N A#k- -)#k '*@]ސ@^֒2` .&'`$ LL,```&N`L"!,`  , @^"@ 8=`"@*" @ 2M"M,``M`,``M,`㿈@[㿠   @^`0+` ; - @^ ` @ 4`@ : $.$`N  J   *``* " &J`. ̐y㿠   g@]:`> @ @]<`:`2㿠`  -.    0.. d@]"g:`< # /``0.-$`0..##z@]}a:`< %(``0.'@-@,$!@]n"g>:` *0. *& 0..+ c 2%@]WӉ:`z< !-  0."*-`$ @]Ha<:`# ,``0.&/`@, $@]9g:`>"/  0.*& `0..7a⠀C6@]":` <  +  0. *" .`*`Ӷ$ @]>z:`%(``0.'@-@, &@]:`=`$*0.! /  .`%@@\"g:`< # /``0.-$`0..7Ц@V>-@\ܒቛ:` < #@ -0.-%@. . ,`$!6@\ɒ#:` =  'z.``0.) '*@ * % @\aӟ>:`%@,``0.&/`@(`&@\:`= $*0.! /  .`%@\"g:`<`# .  0./`$@`0..9&%" g+>-@\⃹:`< '96-  0."+`# ,*`$@\qa:` <&(0.,`%/(`,* $@\^#:` >" .  0.@- #-`/`&!@\Mӣ? z:` @.``0. ,@* '@\>>:`# -0.%+. &@\0"g:`>`$@(0.,&@ 0..'}xz@\k:`< "*``0.# ,#@- @-@. $!@\":`>-? %.0.&@($'6() ' @[ቛ:` =#@ (``0.-`#-@/`@,`%@[㭇:` >Ӛ +``0. / " *@ ,&)@[А<z:`%(``0.'@, @,`$@[>:`"+  0.' * +`&@["g:`<`%@/``0., $@`0..7沄%y@[:` < %*``0.% -& /`;&@ (`$@ ,@($@["k:`=`" .0.#,#@* --%@@[tb:`>-< &@*0.$ ('96(*$ @[ba:` =".0.-%@+. (`,`%@[O#:` =  ,0.*$+  * %@[?aӭ>z:`&.``0. @-@,&@[0= :`g!+``0." , @ ,%@[!:`>`%(``0.@-&@0. .. @[c:`<  -0."@* +  ,`#,'- - $!y@Z#:`>&@+0. @*  (!*"+  ,`&@Zk:`? %@(``0.%, &1>-.`@(('@Zϒ:`=& -  0.#@,`#,-`%@Z!:` 6< 㭶&@.0.('9(* + $ @Z:` <`$.``0.@-%. @(`$@@Z!Ӆ<z:` 9.0."*+ $ @Z<:`%@.``0.%. @(`$@Z}"g>:` *0. *& 0.  . 㿠@ @Y㿘@Z & & 㿘@Z   @ZCa :`< !"+"+  ,` 㿠N # N `&2N   <"N >"N `"2N    2   N 2N /N`"N*  pN` & q u o t ; # 3 2 a m<  "+("" (&" (*N`"(>" (#N`((((`N` g`<" l(((`((((( `((((`(`N` 2N`(㿘BB @Yb`h@ZK6 㿠㿠);Ok[WQ  /?"!,i9Ka~֝jבe  7CA f!*7ΑH^P}zdK5 _U^/%=kO[G)6F\I (QۚK5ަ5)n>5#F[uvT~>QwCBBBBQ00000000000000000000000000000000  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~connection_host_name == NULLconnect.cconnection_host_name != NULLconnect.cConnecting to %s[%s]:%hu... Connecting to %s:%hu... connected. Created socket %d. failed: %s. Closing fd %d Master socket fd %d bound. Closing fd %d Closing fd %d Created socket fd %d. Closing fd %d Closing fd %d Deleted old cookie (to be replaced.) Stored cookie %s %d %s %s %d %s %s %s res != 0cookies.cDiscarded old cookie. name_b != NULL && name_e != NULLcookies.cdomainpathexpiresmax-age%lfsecureError in Set-Cookie, field `%s'Syntax error in Set-Cookie at character `%c'. Syntax error in Set-Cookie: premature end of string. cdm: 1 2 3 4 5 6Attempt to fake the domain: %s, %s Attempt to fake the path: %s, %s p != NULLcookies.cocnt == countcookies.cCookie: pos == result_sizecookies.crCannot open cookies file `%s': %s TRUE%lu%s %s %s %s %lu %s %s Saving cookies to %s. wCannot open cookies file `%s': %s # HTTP cookie file. # Generated by Wget on %s. # Edit at your own risk. Error writing to `%s': %s Error closing `%s': %s Done saving cookies. bytecon != NULLftp.ccon->target != NULLftp.c!((cmd & DO_LIST) && (cmd & DO_RETR))ftp.c(cmd & (DO_LIST | DO_CWD | DO_RETR | DO_LOGIN)) != 0ftp.cuser && passwdftp.cLogging in as %s ... Error in server response, closing control connection. Closing fd %d Error in server greeting. Closing fd %d Write failed, closing control connection. Closing fd %d The server refuses login. Closing fd %d Login incorrect. Closing fd %d Logged in! ==> SYST ... Error in server response, closing control connection. Closing fd %d Server error, can't determine system type. done. ==> PWD ... Error in server response, closing control connection. Closing fd %d /Initial VMS directory not in the form [...]! Preprocessing the initial VMS directory old = '%s' new = '%s' done. ==> TYPE %c ... Error in server response, closing control connection. Closing fd %d Write failed, closing control connection. Closing fd %d Unknown type `%c', closing control connection. Closing fd %d done. ==> CWD not needed. changing working directory %s%s%sPrepended initial PWD to relative path: old: '%s' new: '%s' *ntarget == '/'ftp.cChanged file name to VMS syntax: Unix: '%s' VMS: '%s' ==> CWD %s ... Error in server response, closing control connection. Closing fd %d Write failed, closing control connection. Closing fd %d No such directory `%s'. Closing fd %d done. ==> CWD not required. ==> SIZE %s ... Error in server response, closing control connection. Closing fd %d done. ==> PASV ... Error in server response, closing control connection. Closing fd %d Write failed, closing control connection. Closing fd %d Cannot initiate PASV transfer. Cannot parse PASV response. Closing fd %d couldn't connect to %s:%hu: %s done. ==> PORT ... Error in server response, closing control connection. Closing fd %d Write failed, closing control connection. Closing fd %d socket: %s Closing fd %d Bind error (%s). Invalid PORT. Closing fd %d done. ==> REST %ld ... Error in server response, closing control connection. Closing fd %d Write failed, closing control connection. Closing fd %d REST failed; will not truncate `%s'. Closing fd %d REST failed, starting from scratch. done. ==> RETR %s ... Error in server response, closing control connection. Closing fd %d Write failed, closing control connection. Closing fd %d No such file `%s'. done. ==> LIST ... Error in server response, closing control connection. Closing fd %d Write failed, closing control connection. Closing fd %d No such file or directory `%s'. done. Lying FTP server found, adjusting. accept: %s %s: %s Closing fd %d Length: %s [%s to go] Length: %s [%s to go] (unauthoritative) %s: %s, closing control connection. Closing fd %d %s (%s) - Data connection: %s; %s (%s) - Control connection closed. Closing fd %d %s (%s) - Data transfer aborted. Closing fd %d r%s: %s %s File `%s' already there, not retrieving. (try:%2d)--%s-- %s %s => `%s' Closing fd %d %s (%s) - `%s' saved [%ld] %s URL: %s [%ld] -> "%s" [%d] Removing file due to --delete-after in ftp_loop_internal(): Removing %s. unlink: %s Closing fd %d .listingUsing `%s' as listing tmp file. unlink: %s Removed `%s'. Recursion depth %d exceeded max. depth %d. f != NULLftp.cRemote file no newer than local file `%s' -- not retrieving. Remote file is newer than local file `%s' -- retrieving. The sizes do not match (local %ld) -- retrieving. Invalid name of the symlink, skipping. Already have correct symlink %s -> %s Creating symlink %s -> %s symlink: %s Skipping directory `%s'. %s: unknown/unsupported file type. %s: corrupt time-stamp. Unrecognized permissions for %s. Will not retrieve dirs since depth is %d (max %d). %s%s%s/%sComposing new CWD relative to the initial directory. odir = '%s' f->name = '%s' newdir = '%s' Not descending to `%s' as it is excluded/not-included. Rejecting `%s'. %s: %s No matches on pattern `%s'. Wrote HTML-ized index to `%s' [%ld]. Wrote HTML-ized index to `%s'. Closing fd %d %s %s %s%s%s PASS--> %s --> PASS Turtle Power! --> %s USER331 s/key 331 opiekey PASS%d,%d,%d,%d,%d,%dPORTPASVTYPECWDRESTRETRLISTSYST VMSUNIXWINDOWS_NTMACOSPWD""SIZEtype=JanFebMarAprMayJunJulAugSepOctNovDecrb%s: %s total PLAINFILE; DIRECTORY; SYMLINK; UNKNOWN; implicit perms %0o; perms %0o; month: %s; day: %d; year: %d (no tm); time: %02d:%02d:%02d (no yr); -> link to: %s ... Ignoring `.' and `..'; trailing `/' on dir. trailing `@' on link. trailing `*' on exec. Skipping. rb%s: %s Name: '%s' -- :MYYYY/MM/DD HH:MM - %d/%02d/%02d %02d:%02d Timestamp: %ld Directory File, size %ld bytes wrong VMS permissons! JANFEBMARAPRMAYJUNJULAUGSEPOCTNOVDECrb%s: %s file name: '%s' .DIRName: '%s' Directory File Getting additional line empty line read, leaving listing parser confusing VMS listing item, leaving listing parser second token: '%s' -day: '%s' -nonsense in VMS listing, skipping this line date parsed YYYY/MM/DD HH:MM:SS - %d/%02d/%02d %02d:%02d:%02d Timestamp: %ld ,)confusing VMS permissions, skipping line permissions: %s -> 0%o rb%s: %s Unsupported listing type, trying Unix listing parser. wb%s: %s %s%s%s@ ���Index of /%s on %s:%d���

Index of /%s on %s:%d

  %d %s %02d %02d:%02d         time unknown       File        Directory   Link        Not sure    %s  (%s bytes)-> %s
store is `%s' POSIXLY_CORRECT--%s: option `%s' is ambiguous %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: illegal option -- %c %s: option requires an argument -- %c %s index >= al->faulty && index < al->counthost.ccount > 0host.cReleasing %p (new refcount %d). Deleting unused %p. Caching %s => %s Found %s in host_name_addresses_map (%p) Resolving %s... failed: %s. done. u->host != NULLhost.cHost not foundUnknown erroral->refcount == 1host.cltgtampquotnbspch == '\'' || ch == 0x22html-parse.cch == quote_charhtml-parse.cch == '-'html-parse.cch == '-'html-parse.caappletareabasebgsoundbodyembedfigframeiframeimginputlayerlinkmetaoverlayscripttabletdthhrefcodehrefsrcbackgroundsrcsrcsrcsrchreflowsrcsrcsrcsrcsrcsrcbackgroundbackgroundbackgroundrelhttp-equivnamecontent%s: no base, merge will use "%s". %s: link "%s" doesn't parse. %s: merge("%s", "%s") -> %s %s: merged link "%s" doesn't parse. tagid != -1html-url.chrefhrefrelstylesheetnamehttp-equivrefreshcontentrobotscontentnonenofollow%s: %s Loaded %s (size %ld). no-follow in %s: %d HTTP/bytesnoneKeep-AliveInvalidating fd %d from further reuse. Closing fd %d pc_last_host_ip == NULLhttp.cpc_last_host_ip != NULLhttp.cRegistered fd %d for persistent reuse. Closing fd %d *hs->local_file != NULLhttp.cReusing connection to %s:%hu. Reusing fd %d. Referer: %s Range: bytes=%ld- Wget/%sAuthorizationProxy-Authorization:%d*/*%s %s HTTP/1.0 User-Agent: %s Host: %s%s Accept: %s %s%s%s%s%s%s%s%s ---request begin--- %s---request end--- Failed writing HTTP request: %s. Closing fd %d %s request sent, awaiting response... End of file while parsing headers. Closing fd %d Read error (%s) in headers. Closing fd %d No data receivedMalformed status line(no description) %2d %s%2d %s %2d %sContent-LengthContent-TypeLocationLast-ModifiedSet-CookieWWW-AuthenticateAccept-RangesContent-RangeKeep-AliveConnection inhibit_keep_alive == 0http.cClosing fd %d Authorization failed. Unknown authentication scheme. BasicLocation: %s%s unspecified [following]Closing fd %d text/htmltext/html.htm.html.html The file is already fully retrieved; nothing to do. Closing fd %d Continued download failed on this file, which conflicts with `-c'. Refusing to truncate existing file `%s'. Closing fd %d Closing fd %d Length: (%s to go)ignoredunspecified [%s] Closing fd %d %s: %s Closing fd %d Closing fd %d Warning: wildcards not supported in HTTP. File `%s' already there, will not retrieve. htmlhtm.orig (try:%2d)--%s-- %s %s => `%s' Cannot write to `%s' (%s). Unable to establish SSL connection. ERROR: Redirection (%d) without location. %s: %s ERROR %d: %s. Last-modified header missing -- time-stamps turned off. Last-modified header invalid -- time-stamp ignored. Server file no newer than local file `%s' -- not retrieving. The sizes do not match (local %ld) -- retrieving. Remote file is newer, retrieving. %d %s %s (%s) - `%s' saved [%ld/%ld] %s URL:%s [%ld/%ld] -> "%s" [%d] %s (%s) - `%s' saved [%ld] %s URL:%s [%ld] -> "%s" [%d] %s (%s) - Connection closed at byte %ld. %s (%s) - `%s' saved [%ld/%ld]) %s URL:%s [%ld/%ld] -> "%s" [%d] %s (%s) - Connection closed at byte %ld/%ld. %s (%s) - Read error at byte %ld (%s).%s (%s) - Read error at byte %ld/%ld (%s). %a, %d %b %Y %T%A, %d-%b-%y %T%a, %d-%b-%Y %T%a %b %d %T %Y%s:%s%s: Basic %s realmopaquenonce:::::Authorization: Digest username="%s", realm="%s", nonce="%s", uri="%s", response="%s", opaque="" BasicDigestNTLMBasicAuthorizationNTLMAuthorizationDigest.anonymous-wget@no_proxyHOMEWGETRC%s: %s: %s. .wgetrc%s/.wgetrcrb%s: Cannot read %s (%s). %s: Error in %s at line %d. %s: Error in %s at line %d. /usr/local/etc/wgetrc/usr/local/etc/wgetrc/usr/local/etc/wgetrc%s: Warning: Both system and user wgetrc point to `%s'. %s: BUG: unknown command `%s', value `%s'. %s: %s: Cannot convert `%s' to an IP address. onoff%s: %s: Please specify on or off. alwaysonoffnever%s: %s: Please specify always, on, off, or never. %s: %s: Invalid specification `%s'. inf%s: Invalid specification `%s' %s: Invalid specification `%s' %s: Invalid specification `%s' %s: Invalid specification `%s' %s: %s: Invalid specification `%s'. %s: %s: Invalid specification `%s'. wget-logw%s: %s: %s wget/usr/local/share/localewgetUsage: %s [OPTION]... [URL]... GNU Wget %s, a non-interactive network retriever. Mandatory arguments to long options are mandatory for short options too. Startup: -V, --version display the version of Wget and exit. -h, --help print this help. -b, --background go to background after startup. -e, --execute=COMMAND execute a `.wgetrc'-style command. Logging and input file: -o, --output-file=FILE log messages to FILE. -a, --append-output=FILE append messages to FILE. -d, --debug print debug output. -q, --quiet quiet (no output). -v, --verbose be verbose (this is the default). -nv, --non-verbose turn off verboseness, without being quiet. -i, --input-file=FILE download URLs found in FILE. -F, --force-html treat input file as HTML. -B, --base=URL prepends URL to relative links in -F -i file. --sslcertfile=FILE optional client certificate. --sslcertkey=KEYFILE optional keyfile for this certificate. --egd-file=FILE file name of the EGD socket. Download: --bind-address=ADDRESS bind to ADDRESS (hostname or IP) on local host. -t, --tries=NUMBER set number of retries to NUMBER (0 unlimits). -O --output-document=FILE write documents to FILE. -nc, --no-clobber don't clobber existing files or use .# suffixes. -c, --continue resume getting a partially-downloaded file. --progress=TYPE select progress gauge type. -N, --timestamping don't re-retrieve files unless newer than local. -S, --server-response print server response. --spider don't download anything. -T, --timeout=SECONDS set the read timeout to SECONDS. -w, --wait=SECONDS wait SECONDS between retrievals. --waitretry=SECONDS wait 1...SECONDS between retries of a retrieval. --random-wait wait from 0...2*WAIT secs between retrievals. -Y, --proxy=on/off turn proxy on or off. -Q, --quota=NUMBER set retrieval quota to NUMBER. --limit-rate=RATE limit download rate to RATE. Directories: -nd --no-directories don't create directories. -x, --force-directories force creation of directories. -nH, --no-host-directories don't create host directories. -P, --directory-prefix=PREFIX save files to PREFIX/... --cut-dirs=NUMBER ignore NUMBER remote directory components. HTTP options: --http-user=USER set http user to USER. --http-passwd=PASS set http password to PASS. -C, --cache=on/off (dis)allow server-cached data (normally allowed). -E, --html-extension save all text/html documents with .html extension. --ignore-length ignore `Content-Length' header field. --header=STRING insert STRING among the headers. --proxy-user=USER set USER as proxy username. --proxy-passwd=PASS set PASS as proxy password. --referer=URL include `Referer: URL' header in HTTP request. -s, --save-headers save the HTTP headers to file. -U, --user-agent=AGENT identify as AGENT instead of Wget/VERSION. --no-http-keep-alive disable HTTP keep-alive (persistent connections). --cookies=off don't use cookies. --load-cookies=FILE load cookies from FILE before session. --save-cookies=FILE save cookies to FILE after session. FTP options: -nr, --dont-remove-listing don't remove `.listing' files. -g, --glob=on/off turn file name globbing on or off. --passive-ftp use the "passive" transfer mode. --retr-symlinks when recursing, get linked-to files (not dirs). Recursive retrieval: -r, --recursive recursive web-suck -- use with care! -l, --level=NUMBER maximum recursion depth (inf or 0 for infinite). --delete-after delete files locally after downloading them. -k, --convert-links convert non-relative links to relative. -K, --backup-converted before converting file X, back up as X.orig. -m, --mirror shortcut option equivalent to -r -N -l inf -nr. -p, --page-requisites get all images, etc. needed to display HTML page. Recursive accept/reject: -A, --accept=LIST comma-separated list of accepted extensions. -R, --reject=LIST comma-separated list of rejected extensions. -D, --domains=LIST comma-separated list of accepted domains. --exclude-domains=LIST comma-separated list of rejected domains. --follow-ftp follow FTP links from HTML documents. --follow-tags=LIST comma-separated list of followed HTML tags. -G, --ignore-tags=LIST comma-separated list of ignored HTML tags. -H, --span-hosts go to foreign hosts when recursive. -L, --relative follow relative links only. -I, --include-directories=LIST list of allowed directories. -X, --exclude-directories=LIST list of excluded directories. -np, --no-parent don't ascend to the parent directory. Mail bug reports and suggestions to . spideronnoparentondeleteafteronretrsymlinksonignorelengthonpassiveftponnoclobberonfollowftponcutdirsverboseoffdirstructoffaddhostdiroffremovelistingoffbindaddresshttpkeepaliveoffrandomwaitonbackgroundoncontinueondebugonhtmlextensiononforcehtmlonspanhostsonbackupconvertedonconvertlinksonrelativeonlyonmirrorontimestampingonpagerequisitesonserverresponseonsaveheadersonquietonrecursiveonGNU Wget %s %sCopyright (C) 1995, 1996, 1997, 1998, 2000, 2001 Free Software Foundation, Inc. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. Originally written by Hrvoje Niksic . verboseondirstructonhttpuserhttppasswdheaderdotstylehtmlifyexcludedomainsproxyuserproxypasswdbackupswaitretryfollowtagscookiesloadcookiessavecookiesprogresslimitraterefereracceptlogfilebasecachedomains%s: %s: invalid command ignoretagsglobincludedirectoriesinputreclevelverboseoffaddhostdiroffdirstructoffnoclobberonremovelistingoffnoparentonhttpkeepaliveoff%s: illegal option -- `-n%c' Try `%s --help' for more options. outputdocumentlogfiledirprefixquotarejecttimeouttriesuseragentwaitexcludedirectoriesuseproxy Try `%s --help' for more options. Can't be verbose and quiet at the same time. Can't timestamp and not clobber old files at the same time. %s: missing URL Try `%s --help' for more options. Converted %s to %s DEBUG output created by Wget %s on %s. Removing file due to --delete-after in main(): Removing %s. unlink: %s No URLs found in %s. FINISHED --%s-- Downloaded: %s bytes in %d files Download quota (%s bytes) EXCEEDED! %s received, redirecting output to `%%s'. .netrc%s/%sr%s: Cannot read %s (%s). %s: %s:%d: warning: "%s" token appears before any machine name accountdefaultloginmacdefmachinepassword%s: %s:%d: unknown token "%s" bardot %*s[ skipping %dK ] %5ldK ,dp->dots < opt.dots_in_lineprogress.c%3d%% %s %5ldK . %5ldK defaultbinarymegagigaInvalid dot style specification `%s'; leaving unchanged. percentage <= 100progress.c%2d%% 100% dlsz <= progress_sizeprogress.c %-11s %7.2f%s --.--K/s ETA --:--%d:%02d:%02d%02d:%02d ETA --:--p - bp->buffer <= bp->widthprogress.c forcedotEnqueuing %s at depth %d Queue count %d, maxcount %d. Dequeuing %s at depth %d Queue count %d, maxcount %d. Already downloaded "%s", reusing it from "%s". Not descending further; at depth %d, max. %d. url_parsed != NULLrecur.cRemoving file due to %s in recursive_retrieve(): Removing %s. Removing %s since it should be rejected. unlink: %s Deciding whether to enqueue "%s". Already on the black list. Not following non-HTTP schemes. It doesn't really look like a relative link. The domain was not accepted. Going to "%s" would escape "%s" with no_parent on. %s (%s) is excluded/not-included. htmlhtm%s (%s) does not match acc/rej rules. This is not the same hostname as the parent's (%s and %s). Not following %s because robots.txt forbids it. Decided to load it. Decided NOT to load it. orig_parsed != NULLrecur.cnew_parsed != NULLrecur.cRedirection "%s" failed the test. /index.html!hash_table_contains (dl_url_file_map, url)recur.cfile != NULLrecur.cApparently %s has been removed. Scanning %s (from %s) will convert url %s to local %s will convert url %s to complete Converted %d files in %.2f seconds. wgetj == cntres.c!EOL (p)res.cIgnoring malformed line %duser-agentallowdisallowIgnoring unknown field at line %dCannot open %s: %s%s path %s because of rule `%s'. /robots.txtLoading robots.txt; please ignore errors. deferring a %ld ms sleep (%ld/%ld) until later. sleeping %ld ms msecs >= 0retr.cbytes >= 0retr.c%s: %s. Could not find proxy host. Error parsing proxy URL %s: %s. Error in proxy URL %s: Must be HTTP. htmlhtmmynewloc != NULLretr.c%s: %s. %d redirections exceeded. %s: Redirection cycle detected. Removing file due to --delete-after in retrieve_from_file(): Removing %s. unlink: %s Giving up. Retrying. sleep_between_retrievals: norm=%ld,fuzz=%ld,sleep=%d p2 - newstr == newlenurl.cp2 - newstr == newlenurl.c/?@ftp://%shttp://%s:/;?#/;?#;?#?##*p == 0url.cerror_code >= 0 && error_code < ARRAY_SIZE (parse_errors)url.c%s: %s Loaded %s (size %ld). %s: Invalid URL %s: %s %s.%d%s.%d%s.%dRemoving %s because of directory danger! %s: %s%s/%s%s%s%s%s%s%s?%s/%s?;#scheme_str != NULLurl.cp - result == sizeurl.chttp_proxyftp_proxyConverting %s... nothing to do. Cannot convert links in %s: %s Unable to delete `%s': %s wbCannot convert links in %s: %s Something strange is going on. Please investigate.Skipping %s at position %d. TO_RELATIVE: %s to %s at position %d in %s. TO_COMPLETE: to %s at position %d in %s. %d-%d *s1 != '/'url.c../orig.origCannot back up %s as %s: %s %d; URL=%sto - newname == fsqlenurl.c%s: %s: Not enough memory. mallocreallocstrdup%02d:%02d:%02d%04d-%02d-%02d %02d:%02d:%02dwget-logforkContinuing in background. Output will be written to `%s'. utime(%s): %s Unlinking %s (symlink). Failed to unlink symlink `%s': %s %s.%d\00<0H0T0`0l0x00000000000000 0,080D0P0\0h0t0000000000000~0{0x(0u40r@0oL0lX0id0fp0c|0`0]0Z0W0T0Q0N0K0H0E0B0? 0<09$06003<00H0-T0*`0'l0$x0!0000000 0 00000 0,080D0P0\0h0t000000000000000(040@0L0X0 88 8D"\    oo3ho44(3d ooLTTUUUUUUUUUUUUWWWWWWWWWWWXTX\`dhlptx|πAABEACEACTADADAADDAGOAIDAIMAIRALLALPAMAMYANANAANDANNANTANYAPEAPSAPTARCAREARKARMARTASASHASKATATEAUGAUKAVEAWEAWKAWLAWNAXAYEBADBAGBAHBAMBANBARBATBAYBEBEDBEEBEGBENBETBEYBIBBIDBIGBINBITBOBBOGBONBOOBOPBOWBOYBUBBUDBUGBUMBUNBUSBUTBUYBYBYECABCALCAMCANCAPCARCATCAWCODCOGCOLCONCOOCOPCOTCOWCOYCRYCUBCUECUPCURCUTDABDADDAMDANDARDAYDEEDELDENDESDEWDIDDIEDIGDINDIPDODOEDOGDONDOTDOWDRYDUBDUDDUEDUGDUNEAREATEDEELEGGEGOELIELKELMELYEMENDESTETCEVAEVEEWEEYEFADFANFARFATFAYFEDFEEFEWFIBFIGFINFIRFITFLOFLYFOEFOGFORFRYFUMFUNFURGABGADGAGGALGAMGAPGASGAYGEEGELGEMGETGIGGILGINGOGOTGUMGUNGUSGUTGUYGYMGYPHAHADHALHAMHANHAPHASHATHAWHAYHEHEMHENHERHEWHEYHIHIDHIMHIPHISHITHOHOBHOCHOEHOGHOPHOTHOWHUBHUEHUGHUHHUMHUTIICYIDAIFIKEILLINKINNIOIONIQIRAIREIRKISITITSIVYJABJAGJAMJANJARJAWJAYJETJIGJIMJOJOBJOEJOGJOTJOYJUGJUTKAYKEGKENKEYKIDKIMKINKITLALABLACLADLAGLAMLAPLAWLAYLEALEDLEELEGLENLEOLETLEWLIDLIELINLIPLITLOLOBLOGLOPLOSLOTLOULOWLOYLUGLYEMAMACMADMAEMANMAOMAPMATMAWMAYMEMEGMELMENMETMEWMIDMINMITMOBMODMOEMOOMOPMOSMOTMOWMUDMUGMUMMYNABNAGNANNAPNATNAYNENEDNEENETNEWNIBNILNIPNITNONOBNODNONNORNOTNOVNOWNUNUNNUTOOAFOAKOAROATODDODEOFOFFOFTOHOILOKOLDONONEORORBOREORROSOTTOUROUTOVAOWOWEOWLOWNOXPAPADPALPAMPANPAPPARPATPAWPAYPEAPEGPENPEPPERPETPEWPHIPIPIEPINPITPLYPOPODPOEPOPPOTPOWPROPRYPUBPUGPUNPUPPUTQUORAGRAMRANRAPRATRAWRAYREBREDREPRETRIBRIDRIGRIMRIORIPROBRODROERONROTROWROYRUBRUERUGRUMRUNRYESACSADSAGSALSAMSANSAPSATSAWSAYSEASECSEESENSETSEWSHESHYSINSIPSIRSISSITSKISKYSLYSOSOBSODSONSOPSOWSOYSPASPYSUBSUDSUESUMSUNSUPTABTADTAGTANTAPTARTEATEDTEETENTHETHYTICTIETIMTINTIPTOTOETOGTOMTONTOOTOPTOWTOYTRYTUBTUGTUMTUNTWOUNUPUSUSEVANVATVETVIEWADWAGWARWASWAYWEWEBWEDWEEWETWHOWHYWINWITWOKWONWOOWOWWRYWUYAMYAPYAWYEYEAYESYETYOUABEDABELABETABLEABUTACHEACIDACMEACREACTAACTSADAMADDSADENAFARAFROAGEEAHEMAHOYAIDAAIDEAIDSAIRYAJARAKINALANALECALGAALIAALLYALMAALOEALSOALTOALUMALVAAMENAMESAMIDAMMOAMOKAMOSAMRAANDYANEWANNAANNEANTEANTIAQUAARABARCHAREAARGOARIDARMYARTSARTYASIAASKSATOMAUNTAURAAUTOAVERAVIDAVISAVONAVOWAWAYAWRYBABEBABYBACHBACKBADEBAILBAITBAKEBALDBALEBALIBALKBALLBALMBANDBANEBANGBANKBARBBARDBAREBARKBARNBARRBASEBASHBASKBASSBATEBATHBAWDBAWLBEADBEAKBEAMBEANBEARBEATBEAUBECKBEEFBEENBEERBEETBELABELLBELTBENDBENTBERGBERNBERTBESSBESTBETABETHBHOYBIASBIDEBIENBILEBILKBILLBINDBINGBIRDBITEBITSBLABBLATBLEDBLEWBLOBBLOCBLOTBLOWBLUEBLUMBLURBOARBOATBOCABOCKBODEBODYBOGYBOHRBOILBOLDBOLOBOLTBOMBBONABONDBONEBONGBONNBONYBOOKBOOMBOONBOOTBOREBORGBORNBOSEBOSSBOTHBOUTBOWLBOYDBRADBRAEBRAGBRANBRAYBREDBREWBRIGBRIMBROWBUCKBUDDBUFFBULBBULKBULLBUNKBUNTBUOYBURGBURLBURNBURRBURTBURYBUSHBUSSBUSTBUSYBYTECADYCAFECAGECAINCAKECALFCALLCALMCAMECANECANTCARDCARECARLCARRCARTCASECASHCASKCASTCAVECEILCELLCENTCERNCHADCHARCHATCHAWCHEFCHENCHEWCHICCHINCHOUCHOWCHUBCHUGCHUMCITECITYCLADCLAMCLANCLAWCLAYCLODCLOGCLOTCLUBCLUECOALCOATCOCACOCKCOCOCODACODECODYCOEDCOILCOINCOKECOLACOLDCOLTCOMACOMBCOMECOOKCOOLCOONCOOTCORDCORECORKCORNCOSTCOVECOWLCRABCRAGCRAMCRAYCREWCRIBCROWCRUDCUBACUBECUFFCULLCULTCUNYCURBCURDCURECURLCURTCUTSDADEDALEDAMEDANADANEDANGDANKDAREDARKDARNDARTDASHDATADATEDAVEDAVYDAWNDAYSDEADDEAFDEALDEANDEARDEBTDECKDEEDDEEMDEERDEFTDEFYDELLDENTDENYDESKDIALDICEDIEDDIETDIMEDINEDINGDINTDIREDIRTDISCDISHDISKDIVEDOCKDOESDOLEDOLLDOLTDOMEDONEDOOMDOORDORADOSEDOTEDOUGDOURDOVEDOWNDRABDRAGDRAMDRAWDREWDRUBDRUGDRUMDUALDUCKDUCTDUELDUETDUKEDULLDUMBDUNEDUNKDUSKDUSTDUTYEACHEARLEARNEASEEASTEASYEBENECHOEDDYEDENEDGEEDGYEDITEDNAEGANELANELBAELLAELSEEMILEMITEMMAENDSERICEROSEVENEVEREVILEYEDFACEFACTFADEFAILFAINFAIRFAKEFALLFAMEFANGFARMFASTFATEFAWNFEARFEATFEEDFEELFEETFELLFELTFENDFERNFESTFEUDFIEFFIGSFILEFILLFILMFINDFINEFINKFIREFIRMFISHFISKFISTFITSFIVEFLAGFLAKFLAMFLATFLAWFLEAFLEDFLEWFLITFLOCFLOGFLOWFLUBFLUEFOALFOAMFOGYFOILFOLDFOLKFONDFONTFOODFOOLFOOTFORDFOREFORKFORMFORTFOSSFOULFOURFOWLFRAUFRAYFREDFREEFRETFREYFROGFROMFUELFULLFUMEFUNDFUNKFURYFUSEFUSSGAFFGAGEGAILGAINGAITGALAGALEGALLGALTGAMEGANGGARBGARYGASHGATEGAULGAURGAVEGAWKGEARGELDGENEGENTGERMGETSGIBEGIFTGILDGILLGILTGINAGIRDGIRLGISTGIVEGLADGLEEGLENGLIBGLOBGLOMGLOWGLUEGLUMGLUTGOADGOALGOATGOERGOESGOLDGOLFGONEGONGGOODGOOFGOREGORYGOSHGOUTGOWNGRABGRADGRAYGREGGREWGREYGRIDGRIMGRINGRITGROWGRUBGULFGULLGUNKGURUGUSHGUSTGWENGWYNHAAGHAASHACKHAILHAIRHALEHALFHALLHALOHALTHANDHANGHANKHANSHARDHARKHARMHARTHASHHASTHATEHATHHAULHAVEHAWKHAYSHEADHEALHEARHEATHEBEHECKHEEDHEELHEFTHELDHELLHELMHERBHERDHEREHEROHERSHESSHEWNHICKHIDEHIGHHIKEHILLHILTHINDHINTHIREHISSHIVEHOBOHOCKHOFFHOLDHOLEHOLMHOLTHOMEHONEHONKHOODHOOFHOOKHOOTHORNHOSEHOSTHOURHOVEHOWEHOWLHOYTHUCKHUEDHUFFHUGEHUGHHUGOHULKHULLHUNKHUNTHURDHURLHURTHUSHHYDEHYMNIBISICONIDEAIDLEIFFYINCAINCHINTOIONSIOTAIOWAIRISIRMAIRONISLEITCHITEMIVANJACKJADEJAILJAKEJANEJAVAJEANJEFFJERKJESSJESTJIBEJILLJILTJIVEJOANJOBSJOCKJOELJOEYJOHNJOINJOKEJOLTJOVEJUDDJUDEJUDOJUDYJUJUJUKEJULYJUNEJUNKJUNOJURYJUSTJUTEKAHNKALEKANEKANTKARLKATEKEELKEENKENOKENTKERNKERRKEYSKICKKILLKINDKINGKIRKKISSKITEKLANKNEEKNEWKNITKNOBKNOTKNOWKOCHKONGKUDOKURDKURTKYLELACELACKLACYLADYLAIDLAINLAIRLAKELAMBLAMELANDLANELANGLARDLARKLASSLASTLATELAUDLAVALAWNLAWSLAYSLEADLEAFLEAKLEANLEARLEEKLEERLEFTLENDLENSLENTLEONLESKLESSLESTLETSLIARLICELICKLIEDLIENLIESLIEULIFELIFTLIKELILALILTLILYLIMALIMBLIMELINDLINELINKLINTLIONLISALISTLIVELOADLOAFLOAMLOANLOCKLOFTLOGELOISLOLALONELONGLOOKLOONLOOTLORDLORELOSELOSSLOSTLOUDLOVELOWELUCKLUCYLUGELUKELULULUNDLUNGLURALURELURKLUSHLUSTLYLELYNNLYONLYRAMACEMADEMAGIMAIDMAILMAINMAKEMALEMALIMALLMALTMANAMANNMANYMARCMAREMARKMARSMARTMARYMASHMASKMASSMASTMATEMATHMAULMAYOMEADMEALMEANMEATMEEKMEETMELDMELTMEMOMENDMENUMERTMESHMESSMICEMIKEMILDMILEMILKMILLMILTMIMIMINDMINEMINIMINKMINTMIREMISSMISTMITEMITTMOANMOATMOCKMODEMOLDMOLEMOLLMOLTMONAMONKMONTMOODMOONMOORMOOTMOREMORNMORTMOSSMOSTMOTHMOVEMUCHMUCKMUDDMUFFMULEMULLMURKMUSHMUSTMUTEMUTTMYRAMYTHNAGYNAILNAIRNAMENARYNASHNAVENAVYNEALNEARNEATNECKNEEDNEILNELLNEONNERONESSNESTNEWSNEWTNIBSNICENICKNILENINANINENOAHNODENOELNOLLNONENOOKNOONNORMNOSENOTENOUNNOVANUDENULLNUMBOATHOBEYOBOEODINOHIOOILYOINTOKAYOLAFOLDYOLGAOLINOMANOMENOMITONCEONESONLYONTOONUSORALORGYOSLOOTISOTTOOUCHOUSTOUTSOVALOVENOVEROWLYOWNSQUADQUITQUODRACERACKRACYRAFTRAGERAIDRAILRAINRAKERANKRANTRARERASHRATERAVERAYSREADREALREAMREARRECKREEDREEFREEKREELREIDREINRENARENDRENTRESTRICERICHRICKRIDERIFTRILLRIMERINGRINKRISERISKRITEROADROAMROARROBEROCKRODEROILROLLROMEROODROOFROOKROOMROOTROSAROSEROSSROSYROTHROUTROVEROWEROWSRUBERUBYRUDERUDYRUINRULERUNGRUNSRUNTRUSERUSHRUSKRUSSRUSTRUTHSACKSAFESAGESAIDSAILSALESALKSALTSAMESANDSANESANGSANKSARASAULSAVESAYSSCANSCARSCATSCOTSEALSEAMSEARSEATSEEDSEEKSEEMSEENSEESSELFSELLSENDSENTSETSSEWNSHAGSHAMSHAWSHAYSHEDSHIMSHINSHODSHOESHOTSHOWSHUNSHUTSICKSIDESIFTSIGHSIGNSILKSILLSILOSILTSINESINGSINKSIRESITESITSSITUSKATSKEWSKIDSKIMSKINSKITSLABSLAMSLATSLAYSLEDSLEWSLIDSLIMSLITSLOBSLOGSLOTSLOWSLUGSLUMSLURSMOGSMUGSNAGSNOBSNOWSNUBSNUGSOAKSOARSOCKSODASOFASOFTSOILSOLDSOMESONGSOONSOOTSORESORTSOULSOURSOWNSTABSTAGSTANSTARSTAYSTEMSTEWSTIRSTOWSTUBSTUNSUCHSUDSSUITSULKSUMSSUNGSUNKSURESURFSWABSWAGSWAMSWANSWATSWAYSWIMSWUMTACKTACTTAILTAKETALETALKTALLTANKTASKTATETAUTTEALTEAMTEARTECHTEEMTEENTEETTELLTENDTENTTERMTERNTESSTESTTHANTHATTHEETHEMTHENTHEYTHINTHISTHUDTHUGTICKTIDETIDYTIEDTIERTILETILLTILTTIMETINATINETINTTINYTIRETOADTOGOTOILTOLDTOLLTONETONGTONYTOOKTOOLTOOTTORETORNTOTETOURTOUTTOWNTRAGTRAMTRAYTREETREKTRIGTRIMTRIOTRODTROTTROYTRUETUBATUBETUCKTUFTTUNATUNETUNGTURFTURNTUSKTWIGTWINTWITULANUNITURGEUSEDUSERUSESUTAHVAILVAINVALEVARYVASEVASTVEALVEDAVEILVEINVENDVENTVERBVERYVETOVICEVIEWVINEVISEVOIDVOLTVOTEWACKWADEWAGEWAILWAITWAKEWALEWALKWALLWALTWANDWANEWANGWANTWARDWARMWARNWARTWASHWASTWATSWATTWAVEWAVYWAYSWEAKWEALWEANWEARWEEDWEEKWEIRWELDWELLWELTWENTWEREWERTWESTWHAMWHATWHEEWHENWHETWHOAWHOMWICKWIFEWILDWILLWINDWINEWINGWINKWINOWIREWISEWISHWITHWOLFWONTWOODWOOLWORDWOREWORKWORMWORNWOVEWRITWYNNYALEYANGYANKYARDYARNYAWLYAWNYEAHYEARYELLYOGAYOKE?^^__ ___$_,_0_8_@_D_L_T_\_d_l_t_|_________ _ _ _ _ _ ______````k kk,kSIGHUPSIGUSR1WTF?!.netrcloginpasswordmacdefaccountdotbarB/sK/sM/sG/s--delete-afterrecursive rejection criteriaAllowingRejectingB/sKB/sMB/sGB/s%7.2f %s%.2f %shttp://ftp://No errorUnsupported schemeEmpty hostBad port numberInvalid user name/index.html/index.html*password*11.8 "\3h344(9` 88 8D 8P >p \0δMU 0 X1\DLR^g`r8P `8T `8T ` d8T %1DC04 OCdl ]C uDT D FT G H K, K P Rl (T@ 9VT FU@ [WDp kWH W X( \T d g8P 8T  $8T 3m Fo! M< d vx  4 d xT 8T (  8T +t 4( ?  Q  d mȠ` ~8T  p 0 8T  $ ( H T8 %ی .5,>,I8T XL c p <h ( ,,9p ,,9p , %D :@ N `L t0,9p |   4 p 0, 9p ,'8İN0e4v P HP  ,  H 89p DHL PT) @ S8 e wt0 X   d  D, N8 WX VP 7 d L tp c rzHΰ>p < $   $ %@ %t$ & #,ΰ7>p F[Hcdi@ h; D H ބ, g@   `h   4 $  . 74 Eh V[( eX, o ,z5 TL  t  0Xx !8  0X $!L -25|` A$  Uh`Tg=Xp x  4PL p>p]~oth y\\00,δδ 1p. p$-@D 1 &#